PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00245.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 297aa    MW: 33706.9 Da    PI: 8.4669
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00245.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.13.9e-3853113262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vPvG+grrknk++s
  Rsa1.0_00245.1_g00010.1  53 PTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKNKNNS 113
                              67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3639107IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3155111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.37957111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MLESKDPAIK LFGMKIPLSS TVFEAEEDEL SAEQNQNETL TDQSDKDKTL KKPTKILPCP  60
RCNSMETKFC YYNNYNVNQP RHFCKACQRY WTSGGTMRSV PVGAGRRKNK NNSSSSSHYR  120
HVTINETNGP VLSFSLGDDH KTSNNNFLSP KLLNHHPDVE SRTRSNEMNG LNCIPGVSWP  180
YTWNHGFYPI YPYWNVPMLL SSPNSTLGKH SREEDETIKR KQMNGSVLVP KTLRIDDPNE  240
AAKSSIWTTL GIKNEVMFKG FDSKKEVSIN KEETETSLVL CANPAALSRS VHFHEQI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895971e-174AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130214.10.0PREDICTED: cyclic dof factor 1-like
SwissprotQ8W1E31e-166CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A078JR010.0A0A078JR01_BRANA; BnaAnng29770D protein
STRINGBra029261.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-161cycling DOF factor 1